PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010943151.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family NAC
Protein Properties Length: 367aa    MW: 40838.4 Da    PI: 4.6539
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010943151.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM447.1e-14158754128
             NAM  54 eekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                     +++ wy + ++d ++ +g+ +  +t+ gyWk+  +d ++++ ++ +vg k++  fy g+ap+g++t W+mhey++
  XP_010943151.1  15 RKDIWYLYNPEDPQSLNGDSEFNVTRIGYWKSR-NDLRIFT-GTPTVGRKTMREFYVGKAPNGNRTGWMMHEYQA 87 
                     45689**************************76.6688888.8999***************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100523.5571110IPR003441NAC domain
SuperFamilySSF1019411.57E-1813110IPR003441NAC domain
PfamPF023651.2E-61986IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 367 aa     Download sequence    Send to blast
MPKLFPYVER RAIIRKDIWY LYNPEDPQSL NGDSEFNVTR IGYWKSRNDL RIFTGTPTVG  60
RKTMREFYVG KAPNGNRTGW MMHEYQAEQK TINGINKEQD YSSLCRVFLQ IDERPNHEEQ  120
HNSAIADGAE CDYVEYALLN ILEQEENNLS SRDAENRSQT IGGDEQGQSV LSGTSVTDPI  180
TDDRFEEKYA TCDFSKGDYL ELNDLCSSET SSSSSDNSSL MSVNSDEFFD ADALLRDLEN  240
DHNVRVEEEH GECRYNVSAS VKSNRVVIMP PTPGSVCSNS RSNLVVEGGT SANPIPEEAR  300
ASEPSPSADE LSHSGRASDS GKSPDSHSDQ SSSDSSHGSR TSKGQGSKSA GRIAKLGKKY  360
YCCFRSF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B3e-12310856163NAC domain-containing protein 19
4dul_A3e-12310856163NAC domain-containing protein 19
1ut7_B3e-12310856163NO APICAL MERISTEM PROTEIN
1ut7_A3e-12310856163NO APICAL MERISTEM PROTEIN
1ut4_B3e-12310856163NO APICAL MERISTEM PROTEIN
1ut4_A3e-12310856163NO APICAL MERISTEM PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010943151.10.0PREDICTED: NAC domain-containing protein 78-like isoform X4
TrEMBLM0TKU14e-83M0TKU1_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr7P26050_0011e-82(Musa acuminata)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65910.13e-16NAC domain containing protein 28